PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00018761-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 157aa    MW: 17596.7 Da    PI: 9.6547
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00018761-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-1564111148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd++l++++  +G g W+t + + g+  ++k c++rw +yl
  PSME_00018761-RA  64 KGPWTPEEDLRLINYISAHGEGKWRTLPMKAGLLHCGKGCRLRWVNYL 111
                       79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.34259115IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-1962110IPR009057Homeodomain-like
SMARTSM007175.7E-1063113IPR001005SANT/Myb domain
PfamPF002498.0E-1364111IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-1765128IPR009057Homeodomain-like
CDDcd001672.32E-866111No hitNo description
Gene3DG3DSA:1.10.10.607.3E-4111129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MAATNGQPKI LILFLCAILL LSTANAIRSL ATVCFLRIAL GDTNSKMGRT LTPISCCSYA  60
GLKKGPWTPE EDLRLINYIS AHGEGKWRTL PMKAGLLHCG KGCRLRWVNY LRPNVKRGHI  120
SPDEEEMIKM GRELQTELDF NTFSLAFKIR NLAFNEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767562.12e-36PREDICTED: transcription repressor MYB5-like
RefseqXP_016487365.12e-36PREDICTED: transcription repressor MYB5-like
TrEMBLA5A3672e-36A5A367_9CARY; Myb-like protein P
TrEMBLE5KUG62e-36E5KUG6_FAGTA; Myb-like protein
STRINGPOPTR_0013s05310.12e-34(Populus trichocarpa)
STRINGPOPTR_0019s05210.13e-34(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-33myb domain protein 34